DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxi1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001099246.1 Gene:Foxi1 / 287185 RGDID:1307421 Length:372 Species:Rattus norvegicus


Alignment Length:350 Identity:99/350 - (28%)
Similarity:145/350 - (41%) Gaps:98/350 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGE-QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHN 64
            :|.||:|...: .:|||||.:|.||||..:|::.|.||.||:::.|.||:|.|:...||||:|||
  Rat   104 LPIPSQEELMKLVRPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHN 168

  Fly    65 LSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANL 129
            ||.||||.||||..|.||||.||.|.|....||:||:..|:|||    |:|.......|.:....
  Rat   169 LSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR----KSDASSSTGSLASEKTE 229

  Fly   130 NRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNL 194
            ||..     ..|.....|.::.:.|:      |.:|:..|.....  |.|...|.          
  Rat   230 NRLL-----SSSPKPTEPQEVLDTAS------PDTTSSSPEKRSS--PAPSGTPC---------- 271

  Fly   195 ADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISR 259
                |.|..:..::.:.|                                         .:.|||
  Rat   272 ----LNNFLSTMTAYVNG-----------------------------------------TNPISR 291

  Fly   260 YPTTPAASEEYMSASRSSRTEDPLPPM--HTINAGAHVPFLHYATGANVAGLPASGIPNSPTTYE 322
            ...||..|.|            |:..|  :::|..::.|..:.::..| .|..|:.:|    |..
  Rat   292 SAATPGLSPE------------PVDKMGQNSLNFNSYTPLTNLSSHGN-GGEWANPVP----TNA 339

  Fly   323 LAISHPLFMMAAPIANMHNIYYNNV 347
            |....|:|...:|    |  :||::
  Rat   340 LGYGGPVFNQFSP----H--FYNSI 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 50/87 (57%)
Foxi1NP_001099246.1 FH 117..205 CDD:214627 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.