DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FOXB1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_036314.2 Gene:FOXB1 / 27023 HGNCID:3799 Length:325 Species:Homo sapiens


Alignment Length:314 Identity:140/314 - (44%)
Similarity:162/314 - (51%) Gaps:87/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNL 65
            ||||.|.:|.:|||||||||||||||.||||||||||:|||||.|||||||:|||||||||||||
Human     1 MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKND----------KDLLN 120
            ||||||||:|||||:||||::|||||...|||||||.||||||||:.|:|          ...|.
Human    66 SFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQ 130

  Fly   121 EE----LTALA----NLNRFFFTTRNGGSAAHMS----PLDMNNAAAMRLD-------------- 159
            ::    |:|||    :|.:......|.|..|..|    |..:.|..|....              
Human   131 QQAKLRLSALAASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVP 195

  Fly   160 ---PLPRSTAHMPNSLGPGVPLPHV----------MPASMSGADH-------------------- 191
               |||.....|.:|||.|  .|||          .|.||:..|:                    
Human   196 AAYPLPNQLTTMGSSLGTG--WPHVYGSAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPA 258

  Fly   192 -------TNLADMGLTNLPA-----LTSSEIEGPLSLRPKRSFTIESLITPDKP 233
                   |..|...|..|||     |::|    |.||.|..|.|..|..:|..|
Human   259 IPVPIKPTPAAVPALPALPAPIPTLLSNS----PPSLSPTSSQTATSQSSPATP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 76/87 (87%)
FOXB1NP_036314.2 FH_FOXB2 1..110 CDD:410817 91/108 (84%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..325 11/29 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 168 1.000 Domainoid score I3833
eggNOG 1 0.900 - - E2759_KOG3562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1236900at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - mtm8587
orthoMCL 1 0.900 - - OOG6_106709
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 1 1.000 - - X2160
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.