DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and fkh2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_596764.1 Gene:fkh2 / 2539703 PomBaseID:SPBC16G5.15c Length:642 Species:Schizosaccharomyces pombe


Alignment Length:359 Identity:95/359 - (26%)
Similarity:133/359 - (37%) Gaps:117/359 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YGE-QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFI 72
            ||: :||||||..:.|.||.||.|.|:.||:||.:|:..:||||.....||||:|||||.|..|.
pombe   218 YGDNKKPPYSYSVMIAQAILSSSECMMTLSNIYSWISTHYPYYRTTKSGWQNSIRHNLSLNKAFR 282

  Fly    73 KVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTR 137
            ||||:....|||..|::.|:    |....:.:.||                           |.|
pombe   283 KVPRKSGEQGKGMKWSIVPE----FREEFIAKTRK---------------------------TPR 316

  Fly   138 NGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLTNL 202
            ....::                |:|........|  |.:|:| ::|            .|..|::
pombe   317 KRSPSS----------------PVPLLAKKREGS--PSLPIP-ILP------------KMKDTSI 350

  Fly   203 PALTSSEIEGPLSLRPKRSFTIESLITPDKPE---HPSEDEDDEDDRVDIDVVECSGISRYPT-T 263
            ||           ..|..|.|.....||..|:   .||..|...:::         .:..|.| |
pombe   351 PA-----------AEPASSTTSARDQTPSTPKDVGSPSTAETSAEEK---------QMETYKTPT 395

  Fly   264 PAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHYATGANVAG---LPASGIPNSPTTYELAI 325
            .||..:.:|      |.|                  ||..||.|.   ..|.|.|...:||..:.
pombe   396 HAALSDIIS------THD------------------YALDANSASQTKKAAFGSPIGSSTYPTSS 436

  Fly   326 SHPLFMMAAPIANMHNIYYNNVTLVAPAQQYRSP 359
            ..|.:...| :.|.|:  :..|........||:|
pombe   437 PAPFWKYVA-VPNPHD--WPQVGSYDTISPYRNP 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 43/87 (49%)
fkh2NP_596764.1 COG5025 6..622 CDD:227358 95/359 (26%)
FHA 81..185 CDD:238017
Forkhead 223..308 CDD:278670 43/88 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm47009
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.