DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxd4

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_001055972.2 Gene:Foxd4 / 252886 RGDID:621716 Length:432 Species:Rattus norvegicus


Alignment Length:333 Identity:114/333 - (34%)
Similarity:141/333 - (42%) Gaps:95/333 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLS 66
            |:|:       |||||||:|..|||..||.|.|.||.|..||:.||||||:....||||:|||||
  Rat    99 PQPA-------KPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLS 156

  Fly    67 FNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDK------DLLNEELTA 125
            .||||:|:||.|..||||.||:|.|.:.|||:|||.||||||||.|....      ......:.|
  Rat   157 LNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHHPPPGGHPHCPFPPPAVPA 221

  Fly   126 LANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVM-------- 182
            ...:::       .|.....|.....|.|.....| |||....|  |.| .||.:::        
  Rat   222 TVQVSQ-------PGLLLRYSAPPQPNLAVHPASP-PRSRPCAP--LHP-YPLRYLLLAAPAYAD 275

  Fly   183 -PASMSGAD-HTNLADMGLTNLPAL---------TSSEIEGPLSLRPKRSFTIESLI-------- 228
             |....||| .|:||      :|||         ...:..|..|.|...||||||::        
  Rat   276 EPRKAEGADPATSLA------IPALQPAPGSQPWEGDQGSGSRSRRGCASFTIESIMQGVTGGGT 334

  Fly   229 -----TPDKP-------EHPSEDEDDEDDRVDIDVVECSGISRYPTTPAASEEYMSASRSSRT-- 279
                 .|..|       :||                .|.      ..|.|:........:|||  
  Rat   335 GSAQSPPFAPWSYCHLLQHP----------------PCL------LHPQAASPLFHVPAASRTVL 377

  Fly   280 --EDPLPP 285
              :.|.||
  Rat   378 QQQQPRPP 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 55/87 (63%)
Foxd4XP_001055972.2 Forkhead 103..189 CDD:278670 54/85 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.