DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxi3

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001094934.1 Gene:Foxi3 / 232077 MGIID:3511278 Length:399 Species:Mus musculus


Alignment Length:290 Identity:94/290 - (32%)
Similarity:132/290 - (45%) Gaps:80/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRESYGEQ-KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFN 68
            |||...:. :|||||.:|.||||.|:||:.|.||.||:|:.|.||:|:::...||||:|||||.|
Mouse   120 SREDLMKMVRPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLN 184

  Fly    69 DCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKR---------------------FKLH 112
            |||.||||..|.||||.||.|.|....||:||:..|:|:|                     .:|.
Mouse   185 DCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRAEASSNLTVPSGTSKSEGQSSRLR 249

  Fly   113 KNDK-------DLLN--------------------EELTALANLNRFFFTTRNGGSAAHMSPLDM 150
            .:.|       .:|.                    ..||:...||.|..|         .:.|::
Mouse   250 VSGKLEGDSPSSILRPSQSPEPPEGTKSTASSPGASTLTSTPCLNTFLST---------FNTLNV 305

  Fly   151 NNAAAM-RLDPLPRSTAH-----MPNSLGPGVPLPHVMPASMSGADHTNLADMGLTN-------- 201
            |::::| ....||.|..|     :|:|..|...:|...|.||      .|:.:|.:|        
Mouse   306 NSSSSMGNQRTLPGSRRHLGGTQLPSSTFPNTSVPDSSPDSM------QLSTVGGSNQLSSYYNP 364

  Fly   202 LPALTSSEIEGPLSLRPKRSFT-IESLITP 230
            ....:|.:...|.| .|..:|: :.|||.|
Mouse   365 FSGGSSGDQSSPFS-SPFYNFSMVNSLIYP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 52/87 (60%)
Foxi3NP_001094934.1 Forkhead 129..215 CDD:278670 51/85 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.