DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FOXE1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_004464.2 Gene:FOXE1 / 2304 HGNCID:3806 Length:373 Species:Homo sapiens


Alignment Length:325 Identity:107/325 - (32%)
Similarity:141/325 - (43%) Gaps:102/325 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|.||||..:||:.|.|..||||||:|||:||.|.::||||:||||:.||||:|:||.
Human    53 KPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPRE 117

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSA 142
            ..|||||.||||.|.|.||||:||.||||||||  ::|          |:....:........:|
Human   118 AGRPGKGNYWALDPNAEDMFESGSFLRRRKRFK--RSD----------LSTYPAYMHDAAAAAAA 170

  Fly   143 AHMSPLDMNNAAAMRLDP--LPRSTAHMPNSLGPG-------VPLPHVMPASMSGADHTNLADMG 198
            |..:      |||..:.|  :|.:....|.::..|       .|.|...||:..|          
Human   171 AAAA------AAAAAIFPGAVPAARPPYPGAVYAGYAPPSLAAPPPVYYPAASPG---------- 219

  Fly   199 LTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISRYPTT 263
                               |.|.|.    :.|::|..|.                   :...|:.
Human   220 -------------------PCRVFG----LVPERPLSPE-------------------LGPAPSG 242

  Fly   264 PAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPNSPTTYELAISHP 328
            |..|..:.||...:.|....|      ||        .|||.         |.:|:.|..|.:.|
Human   243 PGGSCAFASAGAPATTTGYQP------AG--------CTGAR---------PANPSAYAAAYAGP 284

  Fly   329  328
            Human   285  284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 58/87 (67%)
FOXE1NP_004464.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..51
FH 53..141 CDD:214627 58/87 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.