DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FOXC2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_005242.1 Gene:FOXC2 / 2303 HGNCID:3801 Length:501 Species:Homo sapiens


Alignment Length:426 Identity:130/426 - (30%)
Similarity:171/426 - (40%) Gaps:120/426 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|..|||.::|||.:.|:.||:||.||||:||:|.|.||||:|||||.|:||:||||.
Human    72 KPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRD 136

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSA 142
            ..:||||:||.|.|.:::||||||.||||:|||  |.|   :::|....|:|.........|..|
Human   137 DKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFK--KKD---VSKEKEERAHLKEPPPAASKGAPA 196

  Fly   143 A-HM--SPLDMNNAAAMR----------------------LDPLPRSTAHMPNSLGPGVPLPHVM 182
            . |:  :|.:......::                      |...|||.|..|.. .|...||...
Human   197 TPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAG-SPDGSLPEHH 260

  Fly   183 PASMSGADHTNLADMGLTNLPALTSSEIEGPLSLRPKR--------------------------- 220
            .|:.:|     |....:.|:..|.:|...|.||....|                           
Human   261 AAAPNG-----LPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQG 320

  Fly   221 -----------SFTIESLIT-PDKPEH----PSEDEDDEDDRVDIDVVECSGISRYPTTP----- 264
                       |....||.| .::|.|    |:.||...|        ..||    ||:|     
Human   321 LEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSD--------HPSG----PTSPLSALN 373

  Fly   265 -AASEEYMSASRSSRTE------------DPLP-PMHTINAGAHVPFLHYATGANVAG--LPASG 313
             ||.:|...|:.....:            .|.| |..|...|        |..|..|.  |..||
Human   374 LAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPG--------AAAAQAASWYLNHSG 430

  Fly   314 IPNSPTTYELAISHPLFMMAAPIANMHNIYYNNVTL 349
            ..|....:..|.....|.....:.|.|.:...|.||
Human   431 DLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTL 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 55/87 (63%)
FOXC2NP_005242.1 FH 72..160 CDD:214627 55/87 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..208 12/45 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..268 11/41 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..420 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.