DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FOXE3

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_036318.1 Gene:FOXE3 / 2301 HGNCID:3808 Length:319 Species:Homo sapiens


Alignment Length:368 Identity:113/368 - (30%)
Similarity:150/368 - (40%) Gaps:130/368 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSF 67
            |..|......|||||||:|.|||:..:|.:.|.|:.||:|||:||.:||.:.::||||:||||:.
Human    61 RRRRRPLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTL 125

  Fly    68 NDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRF 132
            ||||:||||.|..||||.||.|.|.|.|||:|||.||||||||..:                   
Human   126 NDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRAE------------------- 171

  Fly   133 FFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADM 197
                                        ||   ||...:.||.:|.|:...|...|         
Human   172 ----------------------------LP---AHAAAAPGPPLPFPYAPYAPAPG--------- 196

  Fly   198 GLTNLPA-LTSSEIEGPLSLRPKRSFTIESLIT--PD-----KPEHPSEDEDDEDDRVDIDVVEC 254
                 || |......||....|.|.|:::||:.  |:     .||.|.                |
Human   197 -----PALLVPPPSAGPGPSPPARLFSVDSLVNLQPELAGLGAPEPPC----------------C 240

  Fly   255 SGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVP--FLHYATGANVAGLPASGIPNS 317
            :.    |...||:....:|:.|       ||::     :.||  .:..||......|||      
Human   241 AA----PDAAAAAFPPCAAAAS-------PPLY-----SQVPDRLVLPATRPGPGPLPA------ 283

  Fly   318 PTTYELAISHPLFMMAAPIANMHNIYYNNVTLVAPAQQY-RSP 359
                     .||..:|.|.|.:..:        :|.:.| |.|
Human   284 ---------EPLLALAGPAAALGPL--------SPGEAYLRQP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 53/87 (61%)
FOXE3NP_036318.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 2/7 (29%)
FH 71..159 CDD:214627 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.