DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxe1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_620264.1 Gene:Foxe1 / 192274 RGDID:621723 Length:370 Species:Rattus norvegicus


Alignment Length:320 Identity:109/320 - (34%)
Similarity:147/320 - (45%) Gaps:80/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|.||||..:||:.|.|..||||||:|||:||.|.::||||:||||:.||||:|:||.
  Rat    54 KPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPRE 118

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSA 142
            ..|||||.||||.|.|.||||:||.||||||||               .::|:.:          
  Rat   119 AGRPGKGNYWALDPNAEDMFESGSFLRRRKRFK---------------RSDLSTY---------- 158

  Fly   143 AHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLTNLPALTS 207
                |..|::|||        :.|....::.||. :|...|| ..||.:...|.......|....
  Rat   159 ----PAYMHDAAA--------AAAAAAAAIFPGA-VPAARPA-YPGAVYAGYAPPLAAPPPVYYP 209

  Fly   208 SEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISRYPTTPAASEEYMS 272
            :...||.     |.|.    :.|::|..|.                   :...|:....|..:.:
  Rat   210 AASPGPC-----RVFG----LVPERPLSPD-------------------LGPAPSAAGGSCAFAA 246

  Fly   273 ASRSSRTEDPLPPMHT----INAGAHV-----PFLHYATGANVAGLPAS----GIPNSPT 319
            |:.:..|....|.:.|    :|..|:.     |...|..||:.|...|:    ..|.|||
  Rat   247 AAGAPGTGSFQPAVCTGARPVNPAAYAAAYAGPDGAYPQGASSALFAAAAGRLAGPTSPT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 58/87 (67%)
Foxe1NP_620264.1 FH_FOXE 54..142 CDD:410793 58/87 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.