DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and fkh-10

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_492676.2 Gene:fkh-10 / 182874 WormBaseID:WBGene00001442 Length:194 Species:Caenorhabditis elegans


Alignment Length:138 Identity:58/138 - (42%)
Similarity:80/138 - (57%) Gaps:20/138 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVP 75
            :.||.:|||.|.||||.|||:|.:.|:::|::|.:.:||:|.....|:||:|||||.||||:|..
 Worm    40 QPKPQHSYIGLIAMAILSSPQKKMVLAEVYEWIMNEYPYFRSRGAGWRNSIRHNLSLNDCFVKAG 104

  Fly    76 RRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKN------DKDLLNEE------------ 122
            |..:  |||.|||:||.....||.|...|||.:.|:.::      |.|..:||            
 Worm   105 RAAN--GKGHYWAVHPACVKDFERGDFRRRRAQRKVRRHMGLQVEDGDSSDEEGSPGSDPSPPIF 167

  Fly   123 LTALANLN 130
            .|||.|.|
 Worm   168 PTALWNFN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 44/87 (51%)
fkh-10NP_492676.2 Forkhead 41..125 CDD:365978 42/85 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.