DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxk1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_951031.2 Gene:Foxk1 / 17425 MGIID:1347488 Length:719 Species:Mus musculus


Alignment Length:410 Identity:103/410 - (25%)
Similarity:151/410 - (36%) Gaps:116/410 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVP 75
            |.||||||..|...||.|:.::.|.||.||..||..:||||...:.||||:|||||.|..|||||
Mouse   289 ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVP 353

  Fly    76 RRPDRPGKGAYWALHPQAFDMFENGSLLRRRKR----FK---------------LH--------- 112
            |..:.||||::|.:.|.:.......:..:||:|    |:               .|         
Mouse   354 RSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSS 418

  Fly   113 ---------------KNDKDLLNEELTALANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLP 162
                           .:|.||.::    ||::..:.::....||.....|:      .|.:.|.|
Mouse   419 GLQTPECLSREGSPIPHDPDLGSK----LASVPEYRYSQSAPGSPVSAQPV------IMAVPPRP 473

  Fly   163 -----RSTAHMPNSL----------------GPGVPLPHVMPASMSGADHTNLADMGLTNLPALT 206
                 :..|:||.|:                .|.|.:..|:..|.:.|:...||..|.|.    |
Mouse   474 SNLVAKPVAYMPASIVTSQQPSGHAIHVVQQAPTVTMVRVVTTSANSANGYILASQGSTG----T 534

  Fly   207 SSEIEGP-----------LSLRPKRSF-----------TIESLITPDKPEH------PSEDEDDE 243
            |.:..|.           |..:|..:|           |:.|.:.|..|.|      |:......
Mouse   535 SHDTAGTAVLDLGNEARGLEEKPTIAFATIPAASRVIQTVASQMAPGVPGHTVTILQPATPVTIG 599

  Fly   244 DDRVDIDVVECSGISRYPTTPAASEEY--------MSASRSSRTEDPLPPMHTINAGAHVPFLHY 300
            ...:.:..|..:|....||.......|        ::|..||.|  |:........|...|....
Mouse   600 QHHLPVRAVTQNGKHAVPTNSLTGNAYALSSPLQLLAAQASSST--PVVITRVCEVGPEEPAAAV 662

  Fly   301 ATGANVAGLPASGIPNSPTT 320
            :..||.|..||:....|.::
Mouse   663 SVAANAAPTPAASTTTSASS 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 43/87 (49%)
Foxk1NP_951031.2 Interaction with SIN3A and SIN3B. /evidence=ECO:0000269|PubMed:10620510, ECO:0000269|PubMed:22476904 2..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..67
Required for interaction with FOXO4 and MEF2C. /evidence=ECO:0000269|PubMed:22956541 81..406 48/116 (41%)
FHA <88..190 CDD:224630
FHA 96..189 CDD:238017
Forkhead 291..377 CDD:278670 43/85 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..443 4/47 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 665..719 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.