DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and lin-31

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_494704.1 Gene:lin-31 / 173740 WormBaseID:WBGene00003017 Length:237 Species:Caenorhabditis elegans


Alignment Length:256 Identity:115/256 - (44%)
Similarity:144/256 - (56%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNL 65
            ||||.::||.|||||||||.||.|||..|.:|||||::|||:|.||||:||||||||||||||||
 Worm     1 MPRPGKDSYDEQKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLN 130
            ||||||||:|||.||||||:|||:||.|..||||||.|||||||:......|             
 Worm    66 SFNDCFIKIPRRADRPGKGSYWAVHPNASGMFENGSCLRRRKRFRARGGQDD------------- 117

  Fly   131 RFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVP--LPH--VMPASMSGADH 191
                   :.....|.:|..::....:.|.|.|..|..:.:||.|.:|  ||:  :.|..|.....
 Worm   118 -------DDDDFHHPAPSKISRKNPLPLLPEPPITPPLLSSLFPNLPPSLPNFCLFPPGMDPTKS 175

  Fly   192 TNLADMGL--------------TNLPALTSSEIEGPLSLRPK---------RSFTIESLIT 229
            ..|..:.|              ::.|...:|||.|..|...|         .||:|||:::
 Worm   176 LLLNPLSLLLMPHFLKNSSNFESSTPHSETSEISGSGSSSSKTPTPEAGFNSSFSIESILS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 69/87 (79%)
lin-31NP_494704.1 FH 13..101 CDD:214627 69/87 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163359
Domainoid 1 1.000 153 1.000 Domainoid score I2640
eggNOG 1 0.900 - - E2759_KOG3562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I2535
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm14168
orthoMCL 1 0.900 - - OOG6_106709
Panther 1 1.100 - - LDO PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 1 1.000 - - X2160
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.