DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxc2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001095150.1 Gene:Foxc2 / 171356 RGDID:621703 Length:494 Species:Rattus norvegicus


Alignment Length:366 Identity:113/366 - (30%)
Similarity:155/366 - (42%) Gaps:116/366 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|..|||.::|||.:.|:.||:||.||||:||:|.|.||||:|||||.|:||:||||.
  Rat    71 KPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRD 135

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSA 142
            ..:||||:||.|.|.:::||||||.||||:|||    .||:                        
  Rat   136 DKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFK----KKDV------------------------ 172

  Fly   143 AHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLT------- 200
                |.|....|.:: :|.|.|....|.    |.|:          ||....|:..:.       
  Rat   173 ----PKDKEERAHLK-EPPPASAKGAPT----GTPV----------ADGPKEAEKKVVVKSEAAS 218

  Fly   201 -NLPALTSSEI---EGPLSLRPKRS-------------------------FTIESLITPDKPEHP 236
             .||.:|..|.   ||.|...|:.|                         |::|:::|. :...|
  Rat   219 PALPVITKVETLSPEGALQASPRSSASTPAGSPDGSLPEHHAAAPNGLPGFSVETIMTL-RTSPP 282

  Fly   237 SEDEDDEDDRVDIDV----------------------VECSGISRYPTTPAASEEYMSASRSSRT 279
            ..|......|..:.|                      :|.:|.:.|..:..|...|..|.|.:..
  Rat   283 GGDLSPAAARAGLVVPPLALPYAAAPPAAYAQPCAQGLEAAGSAGYQCSMRAMSLYTGAERPAHV 347

  Fly   280 EDPLPPM-------HTINAGAHVPFLHYATGANVAGLPASG 313
              .:||.       |....|:.:..|:.|.|...| |.|||
  Rat   348 --CVPPALDEALSDHPSGPGSPLGALNLAAGQEGA-LGASG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 55/87 (63%)
Foxc2NP_001095150.1 FH_FOXC1 66..158 CDD:410818 54/86 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..213 17/93 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..267 5/33 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..422 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.