DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxe3

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_599166.1 Gene:Foxe3 / 171302 RGDID:621727 Length:286 Species:Rattus norvegicus


Alignment Length:326 Identity:105/326 - (32%)
Similarity:129/326 - (39%) Gaps:113/326 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSF 67
            |..|......|||||||:|.|||:..:|.:.|.|:.||:|||:||.:||.:.::||||:||||:.
  Rat    54 RRRRRPLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTL 118

  Fly    68 NDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRF 132
            ||||:||||.|..||||.||.|.|.|.|||:|||.||||||||         ..||.|       
  Rat   119 NDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFK---------RTELPA------- 167

  Fly   133 FFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADM 197
                                      .|.|      |....|..|.|...||.            
  Rat   168 --------------------------PPPP------PFPYAPFPPAPAPAPAP------------ 188

  Fly   198 GLTNLPALTSSEIEGPLSLRPKRSFTIESLI-------TPDKPEHPSEDEDDEDDRVDIDVVECS 255
                                |.|.|.::||:       .|..||.|.....|             
  Rat   189 --------------------PARLFRLDSLLGLQTEPPGPLAPEPPCCAAPD------------- 220

  Fly   256 GISRYPTTPAASEE--YMSASRSSRTEDPLP--PMHTI--NAGAHVPFLHYATGANVAGLPASGI 314
              :.:|...||:..  |..|........|||  |:..:  :|||..|.     ||..|.|...|.
  Rat   221 --ASFPPCAAAASPPLYSPAPERLGLPAPLPAEPLLALAGSAGALGPL-----GAGEAYLRQPGF 278

  Fly   315 P 315
            |
  Rat   279 P 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 53/87 (61%)
Foxe3NP_599166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 2/7 (29%)
FH 64..152 CDD:214627 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.