DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxa3

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_032286.1 Gene:Foxa3 / 15377 MGIID:1347477 Length:353 Species:Mus musculus


Alignment Length:245 Identity:103/245 - (42%)
Similarity:131/245 - (53%) Gaps:42/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNL 65
            |.:..|......|||||||||..|||..:|.|||.||:||::|.|.|||||:|.||||||:||:|
Mouse   107 MAKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSL 171

  Fly    66 SFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLN 130
            ||||||:||.|.||:||||:||||||.:.:|||||..|||:|||||.:..|           ..|
Mouse   172 SFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKAK-----------KGN 225

  Fly   131 RFFFTTRNG--GSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTN 193
            .....:|||  |||...:   ...|.|:.....|:.|   |:.           |.:.||.|...
Mouse   226 SATSASRNGTAGSATSAT---TTAATAVTSPAQPQPT---PSE-----------PEAQSGDDVGG 273

  Fly   194 LADMGL--TNLPALTSSEIEGPLSLRP----KRSFTIESLI-----TPDK 232
            | |...  ::.|..:..|:.|.|.|..    ...|:|.:|:     ||.|
Mouse   274 L-DCASPPSSTPYFSGLELPGELKLDAPYNFNHPFSINNLMSEQTSTPSK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 62/87 (71%)
Foxa3NP_032286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..83
FH 119..207 CDD:214627 62/87 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..287 20/96 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.