DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxf1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_034556.2 Gene:Foxf1 / 15227 MGIID:1347470 Length:378 Species:Mus musculus


Alignment Length:333 Identity:103/333 - (30%)
Similarity:151/333 - (45%) Gaps:66/333 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPR 76
            :|||||||:|..|||.|||.|.|.||:||:|:..|||::|...|.|:||:|||||.|:||||:|:
Mouse    47 EKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPK 111

  Fly    77 RPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALAN-------LNRFFF 134
            ...|||||.||.:.|.:..|||.||..||.:.|:    .|....:.:.::.|       .:.:.|
Mouse   112 GLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFR----RKCQALKPVYSMVNGLGFNHLPDTYGF 172

  Fly   135 TTRNGGSAAHMS-PLD-----MNNAAAMRLD--PLP-RSTAHMPNSLG----------------- 173
            ....|.|.|..| .|:     ||...|..:|  .|| .|..|:|::.|                 
Mouse   173 QGSGGLSCAPNSLALEGGLGMMNGHLAGNVDGMALPSHSVPHLPSNGGHSYMGGCGGSAAGEYPH 237

  Fly   174 --PGVPLPHVMPASMSGA--DHTNLADMGLTNLPALTSSEIEG-------PLSLRPKRSFTIESL 227
              ..||...::||...|.  .|...:.......||.:::...|       |||.....:..:...
Mouse   238 HDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASAALNSGASYIKQQPLSPCNPAANPLSGS 302

  Fly   228 ITPDKPEHPSEDEDDEDDRVDIDVVECSGISRYPT-TPAASE--EYM---SASRSSRTEDPLPPM 286
            |:....|.|...::..:     ...|..||.||.: :|:..:  |::   :|..||       .|
Mouse   303 ISTHSLEQPYLHQNSHN-----GPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASS-------SM 355

  Fly   287 HTINAGAH 294
            ||...|::
Mouse   356 HTTGGGSY 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 51/87 (59%)
Foxf1NP_034556.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Forkhead 48..133 CDD:306709 49/84 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.