DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxd3

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_034555.3 Gene:Foxd3 / 15221 MGIID:1347473 Length:469 Species:Mus musculus


Alignment Length:255 Identity:101/255 - (39%)
Similarity:132/255 - (51%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFN 68
            |::......|||||||:|..|||..||:|.|.||.|.:||::||||||:....||||:|||||.|
Mouse   122 PNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLN 186

  Fly    69 DCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFF 133
            |||:|:||.|..||||.||.|.||:.|||:|||.||||||||.|:.:.  |.|:...:......:
Mouse   187 DCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEH--LREQTALMMQSFGAY 249

  Fly   134 FTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTA--------HMPNSLGPGVP-LPHVMPASMSGA 189
            ......|:..:..|..::.|||......|.:.|        ..|.:|.|..| ||..:|...||.
Mouse   250 SLAAAAGAGPYGRPYGLHPAAAAGAYSHPAAAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGE 314

  Fly   190 DHTNLADMGLTNLPAL---------------------TSSEIEGPLSLRPKRSFTIESLI 228
            .....|..|....|:|                     |:|.|:...|.||  ||:||::|
Mouse   315 LGRKAAAFGSQLGPSLQLQLNTLGAAAAAAGTAGAAGTTSLIKSEPSARP--SFSIENII 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 56/87 (64%)
Foxd3NP_034555.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..127 1/4 (25%)
Forkhead 131..217 CDD:278670 55/85 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.