DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxl1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_032050.2 Gene:Foxl1 / 14241 MGIID:1347469 Length:336 Species:Mus musculus


Alignment Length:332 Identity:104/332 - (31%)
Similarity:144/332 - (43%) Gaps:100/332 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPR 76
            ||||||||:|.||||..:||:.:.|:.||:||.||||:|..|.|.||||:|||||.|:||:||||
Mouse    48 QKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVPR 112

  Fly    77 RPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGS 141
            ...|||||:||.|.|:..||||||:..||:::.|                               
Mouse   113 EKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPK------------------------------- 146

  Fly   142 AAHMSPLDMNNAAAMRLDP-----------------LPRSTAHMPNSLGPGVPLPHVMPASMSGA 189
            .|..||    .|...|::|                 ||........|...|...|.::|  ..|.
Mouse   147 PAAGSP----EAKRTRVEPPESEVGCDVGSPDLATALPTRAPDRSQSPAVGTARPALLP--WPGP 205

  Fly   190 DHTNL-ADMGLTNLPALTSSEIEGPL-----------SLRPK----RSFTIESLITPDKPEHPSE 238
            :..:. ||:.:....|:.|.:::.|.           |..||    :||:|:|::.. :|...|.
Mouse   206 EPRDPDADLTVQGAGAVASGQLQRPAHHLGSPLCPAPSGSPKGSKSKSFSIDSILAV-RPTPASG 269

  Fly   239 DEDDEDDRVDIDVVECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMH-TINAGAHV------- 295
                         .|..||.: |...|.....::||...     .||.: ::...|||       
Mouse   270 -------------AEAPGIPK-PVPGALGSSLLAASSGL-----APPFNASLVFDAHVQGGFSQL 315

  Fly   296 --PFLHY 300
              |||.|
Mouse   316 GIPFLSY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 56/87 (64%)
Foxl1NP_032050.2 FH 49..137 CDD:214627 56/87 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..214 17/110 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..252 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.