DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxs1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_034356.1 Gene:Foxs1 / 14239 MGIID:95546 Length:329 Species:Mus musculus


Alignment Length:358 Identity:112/358 - (31%)
Similarity:151/358 - (42%) Gaps:104/358 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPSRESYGEQ----KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRH 63
            :||.||....    |||||||:|.||||.|||.:...||.||::|..||.:||.|...||||:||
Mouse     4 QPSPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRH 68

  Fly    64 NLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALAN 128
            |||.|:||:||||...:||||:||.|.|...|||::||.||||:||                   
Mouse    69 NLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRF------------------- 114

  Fly   129 LNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGV---------PLPHVMPA 184
                   |:..|:.....|        :::|..|    |...|..||.         |.|..:| 
Mouse   115 -------TKRTGAQGTKGP--------VKIDHRP----HRATSPDPGAPKTTTGRLCPFPQEVP- 159

  Fly   185 SMSGADHTNLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDI 249
            :..|.....|  ||  :|||..||               ..|.:.|..|..|.|           
Mouse   160 NPKGLSFEGL--MG--SLPANMSS---------------TTSDVRPQLPTGPKE----------- 194

  Fly   250 DVVECSGISRYP------TTPAASEEYMSASRSSRTED----PLPPMHTINAGA----HVPFLHY 300
               .||..|..|      |:|:....:..:|..|..|.    |.|.:...:.|:    .:..|::
Mouse   195 ---MCSAKSGGPRELSEATSPSPCPAFGFSSAFSDAESLGKAPTPGVAPESVGSSYQCRMQTLNF 256

  Fly   301 ATGAN--VAGLPASGIPNSPTTYELAISH--PL 329
            ..|.:  :..|..|.:| :|.:...:.||  ||
Mouse   257 CMGTDPGLEHLLVSSVP-TPGSSTPSASHRAPL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 52/87 (60%)
Foxs1NP_034356.1 Forkhead 18..103 CDD:278670 51/84 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..150 8/44 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..213 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.