DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxd4

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_032048.1 Gene:Foxd4 / 14237 MGIID:1347467 Length:444 Species:Mus musculus


Alignment Length:369 Identity:125/369 - (33%)
Similarity:151/369 - (40%) Gaps:102/369 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLS 66
            |:|:       |||||||:|..|||..||.|.|.||.|..||:.||||||:....||||:|||||
Mouse    99 PQPA-------KPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLS 156

  Fly    67 FNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNR 131
            .||||:|:||.|..||||.||:|.|.:.|||:|||.||||||||.|.                  
Mouse   157 LNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHH------------------ 203

  Fly   132 FFFTTRNGG------------SAAHMS-PLDMNNAAAMRLDPLPRSTAH--MPNSLGPGVPL-PH 180
                ..:||            :..|:| |..:...:|   .|.|...||  .|....|..|| ||
Mouse   204 ----PPSGGHPHCPFPPPAVPATLHVSQPSLLLRYSA---PPQPNLAAHPAAPPRSHPCAPLHPH 261

  Fly   181 VM-------------PASMSGAD-HTNLADMGLTNLPALTSSEIE-----GPLSLRPKRSFTIES 226
            .|             |....||| .|.||...|.  |.|.|...|     |..|.|...||||||
Mouse   262 PMRYLLLAAPAYGDNPRKAEGADPATPLAIPALQ--PVLGSQPWERDQSSGTRSGRGCASFTIES 324

  Fly   227 LITPDKPEHPSEDEDDEDDRVDIDVVECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINA 291
            ::                          .|::...|..|.|..:...|.....:.|...:|...|
Mouse   325 IM--------------------------QGVTGGGTGSAQSPSFAPWSYCHLLQHPPCLLHPQAA 363

  Fly   292 GAHVPFLHYATGANVAGLPASGIPNSPTTYELAISHPLFMMAAP 335
            .   |..|.:.|:... ||....|..|...|   .|...:..||
Mouse   364 S---PLFHMSAGSRTI-LPQQPQPPLPLQQE---QHHCAISCAP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 55/87 (63%)
Foxd4NP_032048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
Forkhead 103..189 CDD:278670 54/85 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..256 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.