DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxi1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_076396.3 Gene:Foxi1 / 14233 MGIID:1096329 Length:372 Species:Mus musculus


Alignment Length:218 Identity:82/218 - (37%)
Similarity:115/218 - (52%) Gaps:34/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGE-QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHN 64
            :|.||:|...: .:|||||.:|.||||..:|::.|.||.||:::.|.||:|.|:...||||:|||
Mouse   104 LPIPSQEELMKLVRPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHN 168

  Fly    65 LSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANL 129
            ||.||||.||||..|.||||.||.|.|....||:||:..|:|||    |:|.   :...::||:.
Mouse   169 LSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR----KSDS---SSSTSSLASE 226

  Fly   130 NRFFFTTRNGGSAAHMSPLD------------MNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVM 182
            .     |.||..|:...|.:            ..::...|..|.|..|..:.|.|.       .|
Mouse   227 K-----TENGLLASSPKPTEPQEVLDTASPDTTTSSPEKRSSPAPSGTPCLNNFLS-------TM 279

  Fly   183 PASMSGAD--HTNLADMGLTNLP 203
            .|.:||.:  ..::|..||::.|
Mouse   280 TAYVSGTNPISRSVATPGLSSEP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 50/87 (57%)
Foxi1NP_076396.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
FH 117..205 CDD:214627 50/87 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..271 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.