DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxe1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_899121.1 Gene:Foxe1 / 110805 MGIID:1353500 Length:371 Species:Mus musculus


Alignment Length:333 Identity:109/333 - (32%)
Similarity:147/333 - (44%) Gaps:101/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|.||||..:||:.|.|..||||||:|||:||.|.::||||:||||:.||||:|:||.
Mouse    55 KPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPRE 119

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSA 142
            ..|||||.||||.|.|.||||:||.||||||||               .::|:.:          
Mouse   120 AGRPGKGNYWALDPNAEDMFESGSFLRRRKRFK---------------RSDLSTY---------- 159

  Fly   143 AHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLTNLPALTS 207
                |..|::|||        :.|....::.||. :|...|| ..||.:...|.......|....
Mouse   160 ----PAYMHDAAA--------AAAAAAAAIFPGA-VPAARPA-YPGAVYAGYAPPLAAPPPVYYP 210

  Fly   208 SEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISRYPTTPAASEEYMS 272
            :...||.     |.|.    :.|::|..|.                   :...|:....|..:.:
Mouse   211 AASPGPC-----RVFG----LVPERPLSPD-------------------LGPAPSAAGGSCAFAA 247

  Fly   273 ASRSSRTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPNSPTTYELAISHP--------- 328
            |:.::.|            |:..|.:  .|||.         |.:|..|..|.:.|         
Mouse   248 AAGAAGT------------GSFQPAV--CTGAR---------PVNPAAYAAAYAGPDGAYPQGAS 289

  Fly   329 --LFMMAA 334
              ||..||
Mouse   290 SALFAAAA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 58/87 (67%)
Foxe1NP_899121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..53
FH 55..143 CDD:214627 58/87 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.