DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxd4l1.2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_002935635.1 Gene:foxd4l1.2 / 100485983 XenbaseID:XB-GENE-876578 Length:338 Species:Xenopus tropicalis


Alignment Length:236 Identity:91/236 - (38%)
Similarity:121/236 - (51%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFND 69
            |:.|....|||||||:|..|||..||.:.|.||.|..||:.:||||:.....||||:|||||.||
 Frog    89 SKASRAFLKPPYSYIALITMAIVQSPYRKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLND 153

  Fly    70 CFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFF 134
            ||||:||.|..||||.||.|.|.:.|||:|||.||||||||.|  .::|:.:   .....|...:
 Frog   154 CFIKIPREPGNPGKGNYWTLDPASKDMFDNGSFLRRRKRFKRH--HQELIKD---GFLMYNPLHY 213

  Fly   135 TTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGP-----GVPLPHVMPASMSGADHTNL 194
            .|      .:.:|........|   .:|::.| |||.|.|     .||.|               
 Frog   214 IT------PYSAPQTQTPVICM---AIPQNLA-MPNHLAPYPHKIKVPCP--------------- 253

  Fly   195 ADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLI-TPDKPE 234
             |.|:..   :..::.....:...|.||:||::: .|.:||
 Frog   254 -DQGVNR---VFKAQDNHHTASHHKCSFSIENIMGEPKEPE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 53/87 (61%)
foxd4l1.2XP_002935635.1 Forkhead 97..182 CDD:365978 51/84 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4152
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.