DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxl2b

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001304690.1 Gene:foxl2b / 100149117 ZFINID:ZDB-GENE-170803-1 Length:285 Species:Danio rerio


Alignment Length:213 Identity:79/213 - (37%)
Similarity:105/213 - (49%) Gaps:49/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPR 76
            |||||||::|.||||..|.||.|.||.||::|..:||:|.||.:.||||:|||||.|:|||||||
Zfish    41 QKPPYSYVALIAMAIRESTEKRLTLSGIYQYIITKFPFYEKNKKGWQNSIRHNLSLNECFIKVPR 105

  Fly    77 RPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFK-------LH-KNDKDLLNEELTALANLNRFF 133
            ......||.||.|.|...||||.|: .|||:|.|       .| :..|.|.              
Zfish   106 EGGGERKGNYWTLDPACEDMFEKGN-YRRRRRMKRPFRPPAAHFQAGKSLF-------------- 155

  Fly   134 FTTRNGGSA--------AHMSPLDMNNAAAMRLDPLPR---STAHMPN-SLG--PGVPLPHVMPA 184
                 ||.|        .::....||::..:...|.|.   ::..||| ::|  ..:..|...| 
Zfish   156 -----GGDAYTGYLPAPKYLQSGFMNSSWPLPQPPPPAMSYASCQMPNGNMGAMKALSTPSYNP- 214

  Fly   185 SMSGADHTNLADMGLTNL 202
                  ::.:..|||.|:
Zfish   215 ------YSRMQAMGLPNM 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 52/87 (60%)
foxl2bNP_001304690.1 FH 42..130 CDD:214627 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.