DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxc1a

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_571803.1 Gene:foxc1a / 100148408 ZFINID:ZDB-GENE-010302-1 Length:476 Species:Danio rerio


Alignment Length:407 Identity:121/407 - (29%)
Similarity:181/407 - (44%) Gaps:76/407 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLS 66
            |:|..:..  .|||||||:|..|||.:||:|.:.|:.||:||.:|||:||.|.|.||||:|||||
Zfish    65 PQPQPKDM--VKPPYSYIALITMAIQNSPDKKVTLNGIYQFIMERFPFYRDNKQGWQNSIRHNLS 127

  Fly    67 FNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNR 131
            .|:||:||||...:||||:||.|.|.:::||||||.||||:|||.....||..:..:...     
Zfish   128 LNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAMKDKEDRGVKEA----- 187

  Fly   132 FFFTTRNGGSAAHMSPLDMNNAAAMRLDPL--PRSTAHMPNSLG------PGVPLPHVMPASMSG 188
               .:|.....|......:..:..:|:..:  ...|:..|.::.      |.:..|....:..||
Zfish   188 ---PSRQAQPQAREQEQSVPGSQPVRIQDIKTENGTSTPPQAVSPTLSTVPKIESPDSSSSMSSG 249

  Fly   189 ADHTNLADMGLTNLPALTSSEIEGPLSL---------RPKRSFTIESLITPDKPEHPSEDEDDED 244
            :.|         ::|:..|      |||         .|.:.|::::::|..:....|..|    
Zfish   250 SPH---------SIPSTRS------LSLDSAGEQHHQAPAQGFSVDNIMTSLRGSPHSSGE---- 295

  Fly   245 DRVDIDVVECSGISRYPTTPAASEEYMSASRSSRTEDPLPP---MHTINAGAHV---PFLHYATG 303
              :...:|   ..||...||..|..| |.::||....|...   ..|.||..|.   ....||.|
Zfish   296 --LTPSLV---APSRTGITPTLSLNY-SPNQSSVYSSPCSQNSISTTSNATYHCNMQAMSLYAGG 354

  Fly   304 ANVAGLPASG------IPN-SPTTYELAISHPLFMMAAPIANMH-----NIYYN------NVTLV 350
            .....|..:.      :|: |.||...::||.....|....:.|     :.|.|      ::...
Zfish   355 DRSGHLGTTATTVDETLPDYSITTTTSSLSHGNLSSAQEGHHPHQGRLASWYLNQAGDIGHLGAT 419

  Fly   351 APAQQYRSPEVQNRIDN 367
            .||||.....|:...::
Zfish   420 YPAQQQNFHSVREMFES 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 54/87 (62%)
foxc1aNP_571803.1 Forkhead 74..160 CDD:278670 52/85 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..271 20/124 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..303 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.