DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxg1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:343 Identity:105/343 - (30%)
Similarity:149/343 - (43%) Gaps:88/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPR 76
            :|||:||.:|..|||..||||.|.|:.||:||...|||||:|.|.||||:|||||.|.||:||||
 Frog   123 EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPR 187

  Fly    77 RPDRPGKGAYWALHPQAFDMFENGSL--LRRR---KRFKL-HKNDKDLLNEELTALANLNRFFFT 135
            ..|.||||.||.|.|.:.|:|..|:.  ||||   .|.|| .|....|.:..||         |.
 Frog   188 HYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLT---------FM 243

  Fly   136 TRNGGSAAHMSP-LDMNNAAAMRLDPLPRSTAHM----PNSLGPGVPLPH--VMPASMSGADHTN 193
            .|.|.....||| |.:::         ||:::.:    ..|..|..|:|:  |:..:..|::|:.
 Frog   244 DRAGSLYWPMSPFLSLHH---------PRASSALSYNGTTSAYPSHPMPYSSVLTQNSLGSNHSF 299

  Fly   194 LADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGIS 258
            ....|| ::..|.:.||  |.:.....:..:.:.:....|                  |.|||..
 Frog   300 STSNGL-SVDRLVNGEI--PYATHHLTAAALAASVPCGLP------------------VPCSGTY 343

  Fly   259 R---------------------YPTTPAASEEYMSASRSSRTEDP--------------LPPMHT 288
            .                     :|:..:.|...|:|..:|.:..|              ||...|
 Frog   344 SLNPCSVNLLAGQTGYFFPHVPHPSITSQSSTSMAARAASSSTSPQAPSTLPCESLRPALPSFTT 408

  Fly   289 -INAGAHVPFLHYATGAN 305
             ::.|....|.|...|::
 Frog   409 GLSGGLSDYFTHQNQGSS 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 53/87 (61%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.