DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxg1d

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001116096.1 Gene:foxg1d / 100142648 ZFINID:ZDB-GENE-080305-12 Length:316 Species:Danio rerio


Alignment Length:263 Identity:92/263 - (34%)
Similarity:116/263 - (44%) Gaps:84/263 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYGEQ--------------KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNT 54
            ||.|...|:              |||:||.:|..|||..||||.|.|:.||:||...||:||::.
Zfish    39 PSEERSSEKAKDAEDAGKPVKLDKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPFYREHK 103

  Fly    55 QRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSL--LRRR---KRFKLHKN 114
            |.||||:|||||.|.||:||||..|.||||.||.|.|.:.|:|..|:.  ||||   .|.||   
Zfish   104 QGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSATSRGKL--- 165

  Fly   115 DKDLLNEELTALANLNRFFFTTRNGGSAAHMSPLDM-------NNAAAMRLDPL---------PR 163
                      |:....||             |||.:       ||....:|.||         |.
Zfish   166 ----------AIKRGLRF-------------SPLGLHGITETANNPLYWQLSPLLSLHHHHHHPH 207

  Fly   164 ---------STAHMPNSLGPGV------PLPHVMPASMSGADHTNLADMGLTNLPALTSSEIEGP 213
                     :.||...|...||      ..|..:....|||       :||:|...::||.: |.
Zfish   208 YNGTSHGFLNQAHGYGSFVHGVEHLGSREAPRAVLGGSSGA-------LGLSNGYGMSSSPV-GL 264

  Fly   214 LSL 216
            ||:
Zfish   265 LSV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 51/87 (59%)
foxg1dNP_001116096.1 FH 62..150 CDD:214627 51/87 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.