DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxf2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001093702.1 Gene:foxf2 / 100101712 XenbaseID:XB-GENE-484646 Length:381 Species:Xenopus tropicalis


Alignment Length:356 Identity:105/356 - (29%)
Similarity:160/356 - (44%) Gaps:72/356 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPR 76
            :|||||||:|..|||.|||.|.|.||:||:|:..|||::|.:.|.|:||:|||||.|:||||:|:
 Frog    61 EKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPK 125

  Fly    77 RPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNG-G 140
            ...|||||.||.:.|.:..|||.||..||.:.|:          .:..||..:.|..    || |
 Frog   126 GLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFR----------RKCQALKPMYRMM----NGIG 176

  Fly   141 SAAHMSPLDMN----------NAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLA 195
            .:..:.|...:          ::....||.:..|.|...:.|..|..:||:.|         |..
 Frog   177 FSTSILPQGFDFQAPPASLTCHSNGYNLDMMSNSMAGGYDGLAGGHHVPHMSP---------NPG 232

  Fly   196 DMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISRY 260
            ...:.:.|..:|.:. ||.|         .|...|..|...|             .:||......
 Frog   233 STYMASCPVSSSGDY-GPDS---------SSSPVPSSPAMAS-------------AMECHSPYTS 274

  Fly   261 PTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPNSPTTYELAI 325
            ||...||    |.:.....:.|:||.:..:||.|       ||.:...|..|.:..:|.. :|::
 Frog   275 PTAHWAS----SGASPYLKQQPMPPSNGASAGIH-------TGVSPYSLEQSYLHQNPRE-DLSV 327

  Fly   326 SHPLFM-MAAPIANMHN--IYYNNVTLVAPA 353
            ..|.:. .::|:.:..:  :.:|.::...|:
 Frog   328 GLPRYQHHSSPVCDRKDFVLNFNGISSFHPS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 51/87 (59%)
foxf2NP_001093702.1 Forkhead 61..147 CDD:365978 49/85 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.