DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxd7

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001082957.1 Gene:foxd7 / 100037333 ZFINID:ZDB-GENE-070410-88 Length:308 Species:Danio rerio


Alignment Length:216 Identity:84/216 - (38%)
Similarity:108/216 - (50%) Gaps:32/216 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYGEQ-KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSF 67
            ||..|.... |||||||:|..|||..||:|.|.||:|..||:.||.|||:....||||:|||||.
Zfish    54 PSSSSKSSSVKPPYSYIALITMAILQSPKKRLTLSEICDFISHRFVYYREKFPAWQNSIRHNLSL 118

  Fly    68 NDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEEL---TALANL 129
            ||||:|:||.|..||||.||.|.|.:.|||||||.||||||||.......:..::.   :...||
Zfish   119 NDCFVKMPREPGNPGKGNYWTLDPNSSDMFENGSFLRRRKRFKRQHFKFGVFKDQALQPSGFPNL 183

  Fly   130 NRFFFTTRNGGSAAHMSPLDM--------------------------NNAAAMRLDPLPRSTAHM 168
            :  :.......|.||:..||:                          .|:.|.:..|..::.|..
Zfish   184 S--YGAYGLSASCAHLPALDVYPYSFHQHIGVPPVGSILPALSTLFSRNSVAAKSFPQSQTVAIE 246

  Fly   169 PNSLGPGVPLPHVMPASMSGA 189
            |.:.|....:....|.:.|.|
Zfish   247 PVTPGIACAMAPTSPYASSAA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 55/87 (63%)
foxd7NP_001082957.1 Forkhead 67..150 CDD:278670 50/82 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.