DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and si:ch211-145o7.3

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_001923743.3 Gene:si:ch211-145o7.3 / 100003583 ZFINID:ZDB-GENE-061207-6 Length:332 Species:Danio rerio


Alignment Length:249 Identity:73/249 - (29%)
Similarity:108/249 - (43%) Gaps:56/249 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPR- 76
            |||||:.||..|||..||||.||:..||::|.:.||||::....|:||:|||||.:..|.::.| 
Zfish   109 KPPYSFSSLIFMAIEDSPEKSLPVKGIYEWIVENFPYYKEAPGGWRNSVRHNLSLSKSFQRIHRD 173

  Fly    77 RPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGS 141
            :....|||:.|.:.|:    :....|...||....|:.::.|||:.:...|        |.||  
Zfish   174 KSQSVGKGSLWRVCPE----YRPALLEVLRKTHYCHRTNRSLLNKPVLLEA--------TDNG-- 224

  Fly   142 AAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLTNLPALT 206
                  .:|.| ..|.|..|...:::.|.|..|               ||..|..|....||.:|
Zfish   225 ------QNMFN-ETMELSDLDSLSSNPPCSFTP---------------DHEELIPMESVGLPEVT 267

  Fly   207 SSEIE-------GPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVE 253
            ..:.|       |.:.|...:....:.|:.|.            |..:|::.||
Zfish   268 GEDTEKDPLADSGYIELHYYQYQQYQYLVLPG------------DTELDLETVE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 38/88 (43%)
si:ch211-145o7.3XP_001923743.3 Forkhead 109..196 CDD:278670 38/90 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.