DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and xxylt1

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_005155910.1 Gene:xxylt1 / 449721 ZFINID:ZDB-GENE-120521-2 Length:387 Species:Danio rerio


Alignment Length:321 Identity:68/321 - (21%)
Similarity:124/321 - (38%) Gaps:71/321 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VHQRPSWVTENKGKMLGYNELQTGKPPLYIVV---VSCGQRVQETL-VMIKSAILFNYDEEYLKF 81
            :..||....|.:||...::.|.     ::..|   :|..|:.|..: .|:|..   .:.|:.:..
Zfish    77 LESRPGAGAELEGKPKRFHALM-----MFTKVDKSLSLQQKFQTAMRSMVKHG---RFLEDEILV 133

  Fly    82 VIFTEDGKGDEFREKLTDWRDIKPFTFDFEIL------------PL------KFPSGNEVEWRN- 127
            :.:..|....||.||:.. ..:...:|.:|::            |:      .|.:|:...:.: 
Zfish   134 LHYVSDLGSQEFGEKMLP-ELLLDASFQYEVVFHNVDTLTEKLFPIVEAMQKHFSAGSGAYYSDA 197

  Fly   128 LFKPCAAQRLFLPSLLTHVDSLLYVDTDILFLSPISDIWRFFKKFNETQMSALTPE--------- 183
            :|....|....:|:.|..:   :.:|.|:.|.|.|.|:::.|..|....:..:..|         
Zfish   198 IFFLSVAMHRIMPAELKRI---VQLDLDLKFRSNIRDLFQEFNHFPSDAVIGIAREMQPVYRHTF 259

  Fly   184 --HENENIGWYNRFARHPFYGRLGVNSGVMLMNLTRMR------EMKWEQHIVSIHKEYKLRIIW 240
              :..||.  .:|....|..|..|.||||||:||..||      ::...:.:..:..:|..|...
Zfish   260 WQYRKENP--KSRVGDPPPDGLPGFNSGVMLLNLDSMRRSTVYNQLLEPERVARLADKYHFRGHL 322

  Fly   241 GDQDIINILFYYHPDKLYIMPCEYNYRPDHCMYMSICNMSQTGVKVIHGN----RGYFHSD 297
            ||||...::...|.:..|.:.|.:|        ..:|...:.     ||.    :.|:|.|
Zfish   323 GDQDFFTMIGMEHTELFYPLTCGWN--------RQLCTWWRD-----HGYGDVFQLYYHCD 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 62/294 (21%)
RfaJ 64..>270 CDD:224359 52/241 (22%)
xxylt1XP_005155910.1 Glyco_tranf_GTA_type 119..>350 CDD:299700 52/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.