DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and large2

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001004538.1 Gene:large2 / 446214 ZFINID:ZDB-GENE-050419-253 Length:750 Species:Danio rerio


Alignment Length:268 Identity:76/268 - (28%)
Similarity:116/268 - (43%) Gaps:48/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LYIVVVSCGQRVQETLVMIKSAILFNYDEEYLKFVIFTEDGKGDEFREKLTDWR--DIKPFTFDF 110
            |::..|..|......:|.:..:||| :....|.|...|:.............|.  .::...:|.
Zfish   132 LHVACVCAGHNASRDVVTLVKSILF-HRRNPLHFHFITDTVANQILSTLFQSWMVPSVQVSFYDA 195

  Fly   111 EILPLKFPSGNEVEW---------RNLFKPCAAQRLFLPSLLTHVDSLLYVDTDILFLSPISDIW 166
            :.|.      :||.|         ..|.|....:.  |||.|:.|   :.:||||.|.:.|:::|
Zfish   196 DELK------SEVSWIPNKHYSGIYGLMKLTLTKA--LPSNLSKV---IVLDTDITFATDIAELW 249

  Fly   167 RFFKKFNETQMSALTPEHENENIGWY--NRFARH---PFYGRLGVNSGVMLMNLTRMREMKWEQ- 225
            ..|:||.|.|:..|.   ||:: .||  |.:..|   |..|| |.|:||:|:.|.|:|.|.||| 
Zfish   250 AIFRKFTEKQVIGLV---ENQS-DWYLGNLWKNHKPWPALGR-GFNTGVILLYLERLRRMGWEQM 309

  Fly   226 -------HIVSIHKEYKLRIIWGDQDIINILFYYHPDKLYIMPCEYNYR-PDHCMYMSICNMSQT 282
                   .::|:     |.....||||.|.....:|..::.:||.:|.: .||.. ...|....:
Zfish   310 WRLTAERELMSM-----LSTSLADQDIFNAFIKQNPVLVHQLPCFWNVQLSDHTR-SEQCYTEVS 368

  Fly   283 GVKVIHGN 290
            .:||||.|
Zfish   369 DLKVIHWN 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 76/268 (28%)
RfaJ 64..>270 CDD:224359 65/230 (28%)
large2NP_001004538.1 GT8_LARGE_C 132..411 CDD:133053 76/268 (28%)
Xylosyltransferase activity. /evidence=ECO:0000250|UniProtKB:O95461 132..407 76/268 (28%)
Glucuronyltransferase activity. /evidence=ECO:0000250|UniProtKB:O95461 408..750
Glyco_transf_49 467..736 CDD:316419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579619
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.