DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and large1

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001004537.1 Gene:large1 / 446213 ZFINID:ZDB-GENE-061204-1 Length:757 Species:Danio rerio


Alignment Length:272 Identity:72/272 - (26%)
Similarity:118/272 - (43%) Gaps:56/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LYIVVVSCGQRVQETLVMIKSAILFNYDEEYLKFVIFTEDGKGDEFREKL--------------T 98
            ::|.:|..|......:|.:..::|| :....|.|.|.|     |....|:              .
Zfish   139 IHIAIVCAGYNASRDVVTLVKSVLF-HRRNPLHFHIIT-----DSIARKILADLFHTWMVPAVHV 197

  Fly    99 DWRDIKPFTFDFEILPLKFPSGNEVEWRNLFKPCAAQRLFLPSLL-THVDSLLYVDTDILFLSPI 162
            ::.|......:...:|.|..||..          ...:|.|...| :.::.::.:||||.|.:.|
Zfish   198 NFYDADELKSEVSWIPNKHYSGIH----------GLMKLVLTKTLPSDLEKVIVLDTDITFATDI 252

  Fly   163 SDIWRFFKKFNETQMSALTPEHENENIGWY--NRFARH---PFYGRLGVNSGVMLMNLTRMREMK 222
            :::|..|.||...|:..|.   ||:: .||  |.:..|   |..|| |.|:||:|:.|.|:|::|
Zfish   253 AELWVVFHKFKGQQVLGLV---ENQS-DWYLGNLWKNHRPWPALGR-GFNTGVILLLLDRLRKLK 312

  Fly   223 WEQ--------HIVSIHKEYKLRIIWGDQDIINILFYYHPDKLYIMPCEYNYR-PDHCMYMSICN 278
            |||        .::|:     |.....||||.|.:...:|..::.:||.:|.: .||.. ...|.
Zfish   313 WEQMWRLTAERELMSM-----LSTSLADQDIFNAVIKQNPFLVHQLPCYWNVQLSDHTR-SEKCY 371

  Fly   279 MSQTGVKVIHGN 290
            ...:.:||||.|
Zfish   372 KDVSDLKVIHWN 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 72/272 (26%)
RfaJ 64..>270 CDD:224359 61/234 (26%)
large1NP_001004537.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..127
RfaJ 137..>387 CDD:224359 72/272 (26%)
GT8_LARGE_C 139..418 CDD:133053 72/272 (26%)
Xylosyltransferase activity. /evidence=ECO:0000250|UniProtKB:O95461 139..414 72/272 (26%)
Glucuronyltransferase activity. /evidence=ECO:0000250|UniProtKB:O95461 415..757
Glyco_transf_49 474..743 CDD:290607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.