DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and Xxylt1

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_344028.5 Gene:Xxylt1 / 363799 RGDID:1308154 Length:392 Species:Rattus norvegicus


Alignment Length:219 Identity:50/219 - (22%)
Similarity:82/219 - (37%) Gaps:58/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EILPLKFPSGNEVEWR-NLFKPCAAQRLFLPSLLTHVDSLLYVDTDILFLSPISDIWRFFKKFNE 174
            |.:...|.:|:...:. ::|....|....:|..:..:   :.:|.|:.:.:.|.:::..|..|..
  Rat   185 EAMQKYFSAGSGTYYSDSIFFLSVAMHQIMPKEILRI---IQLDLDLKYKTNIRELFEEFDNFLP 246

  Fly   175 TQMSALTPE-------------HENENIGWYNRFARHPFYGRLGVNSGVMLMNLTRMR------- 219
            ..:..:..|             |||..    .|....|..|..|.||||||:||..||       
  Rat   247 GAVIGIAREMQPVYRHTFWQFRHENPK----TRVGDPPPEGLPGFNSGVMLLNLEAMRQSPLYGH 307

  Fly   220 --EMKWEQHIVSIHKEYKLRIIWGDQDIINILFYYHPDKLYIMPCEYN------YRPD------- 269
              |..|.|.:..   :|..|...||||...::...||:..:::.|.:|      :|..       
  Rat   308 LLEPAWVQQLAD---KYHFRGHLGDQDFFTMIGMEHPELFHVLDCTWNRQLCTWWRDHGYSDVFP 369

  Fly   270 ---HCMYMSICNMSQTGVKVIHGN 290
               ||         :..||:.|||
  Rat   370 AYFHC---------EGHVKIYHGN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 50/219 (23%)
RfaJ 64..>270 CDD:224359 43/197 (22%)
Xxylt1XP_344028.5 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.