DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and bgnt-1.5

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001024774.1 Gene:bgnt-1.5 / 3565692 WormBaseID:WBGene00010694 Length:403 Species:Caenorhabditis elegans


Alignment Length:312 Identity:59/312 - (18%)
Similarity:114/312 - (36%) Gaps:100/312 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ENKGKMLGYNELQT-------GKPPLYIVVVSCGQRVQETLVMIKSAILFNYD------------ 75
            :|....:|||.|:.       |..|:.:.|    ....|.:..|:...| |:|            
 Worm    55 QNDEYCVGYNFLEATNMFREDGLEPVTLAV----HGTSEMMKAIEKKPL-NWDGPISFGLFIDFH 114

  Fly    76 -EEYLKFVIFTEDGKGDE-FREKLTDWRDIKPFTFDFEILPLKF-PSGNE----VEWRNLFKPCA 133
             .:.|:::  :|..:.|| ||||:|.....:...|......:|. |:..|    :..|:.::..|
 Worm   115 SRQVLEYI--SEVHRCDEKFREKVTVHFAFRLSAFQGSCPQIKISPTNRECKEFLHNRDKYRQAA 177

  Fly   134 AQ--RLFLPSLLTHV-------DSLLYVDTDILF-------LSPISD------------IWRFFK 170
            ..  :|:..:|:.::       |.....|.|::.       :.||::            :.||  
 Worm   178 GGPFQLYPSNLMRNIARQGAKSDIHFIADGDMVMSEGFAMKIKPIANQVIDGTSKNLLVVRRF-- 240

  Fly   171 KFNETQMSALTPEH-------ENENIGWYNRFARHPFYGRLGVNSGVMLMNLTRM--------RE 220
               ||..:.:..:|       :|:.:..::    |.|:     .||..:.|::..        |.
 Worm   241 ---ETNETTIPRDHKQLQESIKNKKVFQFH----HKFF-----FSGHKIANISHWFAVSNNTDRI 293

  Fly   221 MKWEQHIVSIHKEYKLRIIWGDQDIINILFYYHPDKLYIMP------CEYNY 266
            ..||  |......:::::|....|:.|.  .|.|.::.:|.      |..||
 Worm   294 TTWE--IPYSSSLWEVQVILHRNDLYNA--DYFPARIKVMQSLVYSLCRANY 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 52/287 (18%)
RfaJ 64..>270 CDD:224359 50/271 (18%)
bgnt-1.5NP_001024774.1 Glyco_transf_49 79..391 CDD:290607 53/288 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158800
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.