DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and CG11149

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster


Alignment Length:291 Identity:55/291 - (18%)
Similarity:97/291 - (33%) Gaps:100/291 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YFVHQR-PSWVTENKGKMLGYNELQT---GK--PPLYIVV---------------VSCGQRVQET 62
            ||.:|. |.:|..::.::|.|..:.|   |.  .|||..:               ::.|:.:.. 
  Fly   196 YFPNQHMPEYVPYDEAEVLMYPHMCTLANGSLVSPLYTQIPTTDSYKSRANLTYPINVGRNIAR- 259

  Fly    63 LVMIKSAILFNYDEEYLKFVIFTEDGKGDEFREKLTDWRDIKPFTFDFEILPLKFPSGNEVEWRN 127
             :...:..:|..|.|     ::...|..|:|.:.:..         :..:|.|            
  Fly   260 -LATNTHFIFACDIE-----LYPSVGFVDQFLDMVAR---------NHSVLAL------------ 297

  Fly   128 LFKPCAAQRLF-LPSLLTHVDSLLYVDTDILFLSPISDIWRFFKKFNETQMSAL--------TPE 183
              .|...:|:: ||.......:.:.||.|        ::...::| .:.|:..|        .|.
  Fly   298 --DPRQRRRVYPLPVFEIETGAKVPVDKD--------ELLALYRK-QQAQVFHLKLCPTCHTIPG 351

  Fly   184 HENENIGWYNRFAR-----HPFYGRLGVNSGVMLMNLTRMREMK---WEQHIVSIHKE--YKLRI 238
            .|.    |.||.:|     |.|...|              |:.|   ||...||.:.|  :..|:
  Fly   352 QEE----WLNRTSRADDHLHVFSKAL--------------RKWKFRAWEPFYVSDNTEPLFDERV 398

  Fly   239 IWGDQDIINILFYYHPDKLYIMPCE---YNY 266
            .|..|....|...|:..::.:..|.   .||
  Fly   399 TWEGQSNKRIQVSYYCSQVSVSQCNLLLQNY 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 45/256 (18%)
RfaJ 64..>270 CDD:224359 42/225 (19%)
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 55/291 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447385
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.