DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and B4gat1

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001099794.1 Gene:B4gat1 / 293667 RGDID:1309541 Length:415 Species:Rattus norvegicus


Alignment Length:104 Identity:20/104 - (19%)
Similarity:37/104 - (35%) Gaps:29/104 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LKFPSGNEVEW-RNLFKPCAAQRLFLPSLLTHVDSLLYVDTDILFLSPISDIWRFFKKF----NE 174
            :.:..|..:.: .||.:..|.:         ..:..|.:|.|::   |...:||..::.    |.
  Rat   197 INYALGTNISYPNNLLRNLARE---------EANYALVIDVDMV---PSEGLWRSLREMLDQSNH 249

  Fly   175 TQMSALT------------PEHENENIGWYNRFARHPFY 201
            ...:||.            |.::||.:..|......|||
  Rat   250 WDGTALVVPAFEIRRARRMPMNKNELVQLYQVGEVRPFY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 20/104 (19%)
RfaJ 64..>270 CDD:224359 20/104 (19%)
B4gat1NP_001099794.1 Glyco_transf_49 94..408 CDD:404735 20/104 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.