DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and bgnt-1.2

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001300086.1 Gene:bgnt-1.2 / 184865 WormBaseID:WBGene00017723 Length:406 Species:Caenorhabditis elegans


Alignment Length:257 Identity:45/257 - (17%)
Similarity:92/257 - (35%) Gaps:76/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 DEFREKLTDWRDIKPFTFDFEILPLKFPSGNEVEWR----------NLFKPCAAQRLFLPSLLTH 145
            :|||:|:|....|:...|......::.|:.:...|:          :|..|.   :|:..:|:.:
 Worm   131 EEFRKKMTIHFAIRQSAFQQTCPKIQIPASDRTCWKFRADQSYLRSHLSGPF---QLYPSNLMRN 192

  Fly   146 V-------DSLLYVDTDIL----FLSPISDI--------------WRFFKKFNETQMSALTPEHE 185
            :       |....:|.|::    |...:..:              .|.|:..|.|.:.. |....
 Worm   193 LARQGAKSDIHFIMDADMIVSEGFARKLKKVANEMIDGKSKKVLAIRRFESVNGTYLPR-THFEL 256

  Fly   186 NENIGWYNRFA-RHPFYGRLGVNSGVMLMNLTRMREMKWEQHIVSIHK------EYKLRIIWGDQ 243
            .:::.:...|. .|.|:.:     |..:.:|.:..|:..:...||..:      |:::::|....
 Worm   257 KQSMAYSKTFEFHHRFFPQ-----GHHIEHLEQWFEVSKQSTSVSTMEIPFAGYEWEVQVILHRN 316

  Fly   244 DIINILFYYHPDKLYIMPCEYNYRPDHCMYMSICNMSQT------------GVKVIHGNRGY 293
            |..|..  |.|.::.:|         |.:..::|....|            |:|  |.|..|
 Worm   317 DPYNAA--YFPSRIKVM---------HSLIYALCRAGYTFHVPSHVFDVHEGIK--HTNTIY 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 45/257 (18%)
RfaJ 64..>270 CDD:224359 37/220 (17%)
bgnt-1.2NP_001300086.1 Glyco_transf_49 80..393 CDD:290607 45/257 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.