DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and bgnt-1.3

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_507102.1 Gene:bgnt-1.3 / 184798 WormBaseID:WBGene00009032 Length:417 Species:Caenorhabditis elegans


Alignment Length:155 Identity:29/155 - (18%)
Similarity:50/155 - (32%) Gaps:50/155 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 RLGVNSGVMLMNLTRMREMKWEQHIVSIHKEYKLRIIWGDQDIINILFYYHPDKLYIMPCEYNYR 267
            |..::|||:...........||...: :|:          .|..|.  .|.|.::.:|       
 Worm   298 RTSIHSGVVTTKEVAYPGYLWEVQTI-LHR----------NDPYNA--DYFPSRIKVM------- 342

  Fly   268 PDHCMYMSICNMSQT---GVKVIHGNRGYFHSDRQPLFKSIYGA-----MENYQLGSNANTEFLM 324
              |.:..::|....|   ...|...:||..|::      :||..     .|.|.: ..|...::.
 Worm   343 --HSLVYALCRAGYTFHVPTHVFDSHRGIKHTN------TIYSKATIAHQEAYAM-KEAGDRYIK 398

  Fly   325 PL-----HAALSIPSIKNSSCGKIS 344
            .:     |..        |.||:.|
 Worm   399 EMDDLYPHTL--------SQCGEFS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 28/152 (18%)
RfaJ 64..>270 CDD:224359 12/66 (18%)
bgnt-1.3NP_507102.1 Glyco_transf_49 91..404 CDD:290607 24/134 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.