DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and bgnt-1.4

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001256048.1 Gene:bgnt-1.4 / 182795 WormBaseID:WBGene00015982 Length:382 Species:Caenorhabditis elegans


Alignment Length:313 Identity:59/313 - (18%)
Similarity:116/313 - (37%) Gaps:104/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NKGKMLGYNELQT-------GKPPLYIVVVSCGQRVQETLVMIKS-------AILFN-----YDE 76
            |....:|||.|:.       |..|:.:.|    ....|.:.||::       .|.|.     :..
 Worm    60 NNEYCVGYNFLEATESFREDGLEPVTLAV----HGTAEMMEMIENKPENWDGPISFGLFIDFHSR 120

  Fly    77 EYLKFV--IFTEDGKGDEFREKLT---DWRDIKPFTF---DFEILPLKFPSGNEVEWRNLFKPCA 133
            :.|.:|  :::.|   :||::|:|   .:| :.||..   ..::.|.....|..:..|..|:...
 Worm   121 QILDYVAKVYSCD---EEFQKKVTVHFAFR-LSPFQTSCPQIKVSPSTLECGEFLSNRKKFRRAV 181

  Fly   134 AQ--RLFLPSLLTHV-------DSLLYVDTDILF-------LSPISD------------IWRFFK 170
            ..  :|:..:|:.::       |....||.|::.       :.||::            :.||  
 Worm   182 GDSFQLYPSNLMRNIARKGAKSDIHFIVDGDMIMSDGFAEKIKPIANQIVDGKNKNVLVVRRF-- 244

  Fly   171 KFNETQMSALTPEH-------ENENI-GWYNRFARHPFYGRLGVNSGVMLMNLTRMREMK----- 222
               ||..:.:...|       ||:.: .:::||    |:      :|..:.|::....:.     
 Worm   245 ---ETNETTIPHNHIELKNAIENKQVFQFHHRF----FF------AGHKISNISHWFAVSNETDE 296

  Fly   223 ---WEQHIVSIHKEYKLRIIWGDQDIINILFYYHPDKLYIMP------CEYNY 266
               ||  |......:::::|....|:.|.  .|.|.::.:|.      |..||
 Worm   297 ITAWE--IPYSSSLWEVQVILHRNDLYNA--DYFPARIKVMQSLVYSLCRANY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 52/289 (18%)
RfaJ 64..>270 CDD:224359 50/273 (18%)
bgnt-1.4NP_001256048.1 Glyco_transf_49 83..382 CDD:290607 53/290 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.