DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shams and XXYLT1

DIOPT Version :9

Sequence 1:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_689744.3 Gene:XXYLT1 / 152002 HGNCID:26639 Length:393 Species:Homo sapiens


Alignment Length:190 Identity:46/190 - (24%)
Similarity:75/190 - (39%) Gaps:44/190 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LFLPSLLTH------VDSLLYVDTDILFLSPISDIWRFFKKFNETQMSALTPE------------ 183
            :|..|:..|      :..::.:|.|:.|.:.|.:::..|..|....:..:..|            
Human   204 IFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYRHTFWQF 268

  Fly   184 -HENENIGWYNRFARHPFYGRLGVNSGVMLMNLTRMREMKWEQHIV------SIHKEYKLRIIWG 241
             |||..    .|....|..|..|.||||||:||..||:......::      .:..:|..|...|
Human   269 RHENPQ----TRVGGPPPEGLPGFNSGVMLLNLEAMRQSPLYSRLLEPAQVQQLADKYHFRGHLG 329

  Fly   242 DQDIINILFYYHPDKLYIMPCEYN-----YRPDHCMYMSI------CNMSQTGVKVIHGN 290
            |||...::...||...:::.|.:|     :..|| .|..:      |   :..||:.|||
Human   330 DQDFFTMIGMEHPKLFHVLDCTWNRQLCTWWRDH-GYSDVFEAYFRC---EGHVKIYHGN 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 46/190 (24%)
RfaJ 64..>270 CDD:224359 37/162 (23%)
XXYLT1NP_689744.3 UDP-alpha-D-xylose binding. /evidence=ECO:0000250|UniProtKB:Q3U4G3 104..106
Glyco_tranf_GTA_type 120..383 CDD:299700 43/186 (23%)
RfaJ 162..>353 CDD:224359 36/152 (24%)
Interaction with target proteins. /evidence=ECO:0000250|UniProtKB:Q3U4G3 263..266 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.