DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and PRSS27

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:252 Identity:88/252 - (34%)
Similarity:128/252 - (50%) Gaps:22/252 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKI-RVIF 151
            ||......|:|||:.|...::||...|..:|...|||||:.:.:||:||||.:...::.: :|:.
Human    26 CGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCFRNTSETSLYQVLL 90

  Fly   152 GDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPA- 215
            |.. |.:.....|:...|..|..:..:.....:.|:||:.|..|:.|:..|.|:|||    ||: 
Human    91 GAR-QLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLP----DPSV 150

  Fly   216 ----GRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRYKSTR-------ITSSMLCA 267
                |....|.|||..||...||.  |:.::.|||:...:|.....|.|.       |.:.||||
Human   151 IFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDMLCA 215

  Fly   268 G--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
            |  ....|:|:|||||||:...|..:...|::|||.||.|:..||||.||:....||
Human   216 GFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 85/243 (35%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 84/242 (35%)
Tryp_SPc 36..275 CDD:238113 85/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.