DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Tmprss5

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:260 Identity:92/260 - (35%)
Similarity:136/260 - (52%) Gaps:21/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRK 144
            ||| |. :||......|||||:.....::||.|.::...:..||.|:|...:|::||||:...|.
Mouse   203 SLK-CS-ECGARPLASRIVGGQAVASGRWPWQASVMLGSRHTCGASVLAPHWVVTAAHCMYSFRL 265

  Fly   145 SKI---RVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPIC 206
            |::   ||..|........:.|...  |..:|.|..:....::.|:|||:||.||:||..:..:|
Mouse   266 SRLSSWRVHAGLVSHGAVRQHQGTM--VEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVGAVC 328

  Fly   207 LP-RYNYDPAGRIGTVVGWGRTSEGGELPS------IVNQVKVPIMSITECRNQRYKSTRITSSM 264
            || :..:.|.|....|.|||.|.     ||      .:....||::|...|.:....|..:|..|
Mouse   329 LPAKEQHFPWGSQCWVSGWGHTD-----PSHTHSSDTLQDTMVPLLSTYLCNSSCMYSGALTHRM 388

  Fly   265 LCAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLE 327
            ||||  ....|:|||||||||:..:|..:.:||:||||.||.....||||::|::|:.||...::
Mouse   389 LCAGYLDGRADACQGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNRPGVYAKVAEFLDWIHDTVQ 453

  Fly   328  327
            Mouse   454  453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 85/239 (36%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 6/11 (55%)
Tryp_SPc 217..448 CDD:214473 84/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.