DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and gzma

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:244 Identity:80/244 - (32%)
Similarity:116/244 - (47%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEI 158
            ::.|||||.. .....||..|..:....|||.|:.|::||:|||| |:...|.:.|:.|.     
Zfish    25 DVSIVGGKDV-KKALSWMVSIQVNQNHKCGGILIHKEWVLTAAHC-KEDSYSSVTVLIGS----- 82

  Fly   159 TSESQAIQRAVTAVIKHKSFDPDTYN-----NDIALLRLRKPISFSKIIKPICLPRYNYD-PAGR 217
            .|.|:..||    :..|....|:|:|     :||.|:||.|.:.    .||..:|:...| ..|.
Zfish    83 LSLSKGSQR----IAIHNYEIPETFNKKTKKDDIMLIRLSKKVK----AKPYKIPKKEKDVQPGT 139

  Fly   218 IGTVVGWGRTS-EGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPSM--DSCQGDS 279
            ...|.|||.|. :|.:....:..::|.::...:|.....::..||..|||||....  .:|.|||
Zfish   140 KCVVRGWGTTDYKGKQASDKLQMLEVLVVDRVQCNRYYNRNPVITKDMLCAGNTQQHRGTCLGDS 204

  Fly   280 GGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSK-FIPWIKSNLE 327
            ||||.....    :||::|...|||....|.||:.:|| .|.||...|:
Zfish   205 GGPLECEKN----LVGVLSGSHGCGDPKKPTVYTLLSKRHITWINKILK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 79/237 (33%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 79/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.