DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss36

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:281 Identity:95/281 - (33%)
Similarity:141/281 - (50%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LSDTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKD 130
            :|.|:.|.|          |.|||......|||||.......:||...:...|...|||||:...
Mouse    27 VSPTQGEFE----------DLDCGRPEPSSRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPS 81

  Fly   131 YVLSAAHCV---KKLRKS-KIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNN-----D 186
            :|||||||.   ..|..: ::.|:.|.|.|:...|...::...|.:|      ||.|:.     |
Mouse    82 WVLSAAHCFVTNGTLEPADELSVLLGVHSQDGPLEGAHMRSVATILI------PDNYSTVELGAD 140

  Fly   187 IALLRLRKPISFSKIIKPICLPRYNYDPA-GRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSIT 248
            :|||||..|......::|:||||.::..| |......|||...|...||.  ::.:|::.::...
Mouse   141 LALLRLASPAKLGPSVRPVCLPRASHLFAHGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEA 205

  Fly   249 EC-----RNQRYKST-RITSSMLCAGRPS--MDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGR 305
            .|     |...:..| ::...|||||.|:  .|:|||||||||:..:|.::|:.||.|:|.||||
Mouse   206 ACQCLYSRPGPFNLTFQLLPGMLCAGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGR 270

  Fly   306 EGYPGVYSRVSKFIPWIKSNL 326
            ...|||::.|:.:..||:.::
Mouse   271 RNRPGVFTAVAPYESWIREHV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/247 (35%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 86/247 (35%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.