DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss8

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:251 Identity:94/251 - (37%)
Similarity:131/251 - (52%) Gaps:16/251 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCV-KKLRKSKIR 148
            :..|| :..:.||.||......|:||...|.|||...|||||::..:|:|||||. ::..:....
Mouse    34 EASCG-AVIQPRITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAAHCFPREHSREAYE 97

  Fly   149 VIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYD 213
            |..|.|..:..| :..:...|..:|.|.|:..:....||||:||..|::||:.|:|||||..|..
Mouse    98 VKLGAHQLDSYS-NDTVVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANAS 161

  Fly   214 -PAGRIGTVVGWGRTSEGGEL--PSIVNQVKVPIMSITECRNQRY-------KSTRITSSMLCAG 268
             |.|...||.|||..:....|  |..:.|::||::|...| :..|       :...|...|||||
Mouse   162 FPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETC-SCLYNINAVPEEPHTIQQDMLCAG 225

  Fly   269 --RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
              :...|:|||||||||.......:::.||||||..||....||||:..|.:..||
Mouse   226 YVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 91/239 (38%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 91/239 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.