DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss44

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:249 Identity:90/249 - (36%)
Similarity:133/249 - (53%) Gaps:19/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFG 152
            ||  :...|||||:|....::||...:....:..|||||::|.:|::|||||  .......|..|
Mouse   105 CG--HRTARIVGGRPAPARKWPWQVSLQVHKQHICGGSLISKWWVITAAHCV--YGHLDYAVFMG 165

  Fly   153 DHDQEITSESQAIQRAVTAVIKHKSFD-PDTYNNDIALLRLRKPISFSKIIKPICLPRYNY--DP 214
            |.|   ....:.::..|..:|.|:.|. ..|..:||||:.|..|:::|..|:|:|:|..::  .|
Mouse   166 DAD---LWSKRPVRIPVQDIIVHQDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQP 227

  Fly   215 AGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKS------TRITSSMLCA-GRPSM 272
             |.:..|.|||:..|.|....|:.::::.|:...:| ||..|.      |.:....:|. .....
Mouse   228 -GTLCWVTGWGKVLEQGRSSRILQEIELNIIRHEKC-NQILKDIMGNIFTLVQEGGVCGYNEKGG 290

  Fly   273 DSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            |:|||||||||:......:..|||||||:||||.||||||:.||.:..||...|
Mouse   291 DACQGDSGGPLVCEFNKTWVQVGIVSWGLGCGRIGYPGVYTEVSYYRDWIIKEL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/237 (36%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 85/235 (36%)
Tryp_SPc 112..340 CDD:238113 84/234 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.