DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and TPSAB1

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:252 Identity:87/252 - (34%)
Similarity:127/252 - (50%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GFSNEEIRIVGGKPTGVNQYPWMARIVYDGKF---HCGGSLLTKDYVLSAAHC----VKKLRKSK 146
            |.:.:.:.||||:....:::||...:...|.:   .|||||:...:||:||||    ||.|...:
Human    23 GQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALR 87

  Fly   147 IRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYN 211
            :::    .:|.:..:.|.:  .|:.:|.|..|.......|||||.|.:|::.|..:..:.||..:
Human    88 VQL----REQHLYYQDQLL--PVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPAS 146

  Fly   212 YD-PAGRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRY-------KSTRIT-SSML 265
            .. |.|....|.|||.......||.  .:.|||||||....| :.:|       ...||. ..||
Human   147 ETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHIC-DAKYHLGAYTGDDVRIVRDDML 210

  Fly   266 CAGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
            |||....|||||||||||:......:...|:||||.||.:...||:|:||:.::.||
Human   211 CAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/244 (35%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 86/244 (35%)
Tryp_SPc 31..267 CDD:214473 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.