DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:314 Identity:100/314 - (31%)
Similarity:153/314 - (48%) Gaps:68/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GVSNAF----GLSDTEDEVEYTE-NSSLKNCD----------CD-----------CGF---SNEE 94
            |..|.|    |:.|......:.: |:|..|.|          |.           ||.   |:.:
Human   226 GYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQ 290

  Fly    95 IRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKK--------------LRKS 145
            .|||||:......:||...:.......||||::|.:::::|||||:|              ||:|
Human   291 SRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQS 355

  Fly   146 KIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRY 210
              .:.:|...|            |..||.|.::|..|.||||||::|:||::|:.::||:|||  
Human   356 --FMFYGAGYQ------------VEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLP-- 404

  Fly   211 NYDPA-----GRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG-- 268
              :|.     .::..:.|||.|.|.|:...::|..||.::....|.::......||.:|:|||  
Human   405 --NPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFL 467

  Fly   269 RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
            :.::|||||||||||:.|....::::|..|||.||.:...||||..|..|..||
Human   468 QGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/247 (35%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133 11/56 (20%)
Tryp_SPc 292..521 CDD:214473 85/246 (35%)
Tryp_SPc 293..524 CDD:238113 86/247 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8579
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.