DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss56

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:254 Identity:91/254 - (35%)
Similarity:132/254 - (51%) Gaps:20/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEI--------RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRK 144
            ||..::.:        |||||.......:||:.|:...|...|||.|:...:||:||||......
Mouse    93 CGERHQGVANTTRAHGRIVGGSTAPSGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASN 157

  Fly   145 SKI-RVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLP 208
            ..: .|:..:..|    ..||.:..|..::.|..|||.|::||:||::|..|:|.....:|||||
Mouse   158 ELLWTVMLAEGPQ----GEQAEEVQVNRILPHPKFDPQTFHNDLALVQLWTPVSPEGPARPICLP 218

  Fly   209 RYNYD-PAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RP 270
            :.:.: |||....:.|||...|.|.....|.:.:||::|...|:.......| .|:|||||  ..
Mouse   219 QGSREPPAGTPCAIAGWGALFEDGPESEAVREARVPLLSADTCQKVLGPGLR-PSTMLCAGYLAG 282

  Fly   271 SMDSCQGDSGGPLLLSN---GVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            .:|||||||||||..|.   ..:..:.|:.|||.|||..|.||||:||:.|..|::..:
Mouse   283 GIDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVTVFKDWLQEQM 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/234 (38%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 88/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - otm44284
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.